Project name: SH3_L124Q

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA124Q
Energy difference between WT (input) and mutated protein (by FoldX)	1.43978 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2529
• Average score: -1.0063
• Total score value: -60.3753

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4522
82	S	A	-0.6843
83	H	A	-0.7924
84	M	A	0.2647
85	T	A	0.0000
86	F	A	-0.1071
87	V	A	-0.6237
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2410
99	D	A	-1.3224
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.7155
108	L	A	0.0000
109	Q	A	-0.6974
110	I	A	0.4382
111	V	A	1.2529
112	N	A	-0.4186
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6952
120	L	A	0.4089
121	A	A	0.0000
122	H	A	-0.9058
123	S	A	0.0000
124	Q	A	-2.3741	mutated: LA124Q
125	T	A	-1.8027
126	T	A	-1.5042
127	G	A	-1.5039
128	Q	A	-1.7814
129	T	A	-0.7465
130	G	A	0.0000
131	Y	A	0.2237
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1516
140	S	A	-0.1759