Project name: SH3_S134N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134N
Energy difference between WT (input) and mutated protein (by FoldX)	-0.382724 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4711
• Maximal score value: 1.2501
• Average score: -0.9121
• Total score value: -54.7281

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2690
85	T	A	0.0000
86	F	A	-0.0874
87	V	A	-0.5998
88	A	A	0.0000
89	L	A	-0.2579
90	Y	A	-0.6604
91	D	A	-2.8146
92	Y	A	-2.0851
93	E	A	-2.8827
94	S	A	0.0000
95	R	A	-2.7839
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3281
100	L	A	0.0000
101	S	A	-1.9042
102	F	A	0.0000
103	K	A	-3.4711
104	K	A	-2.8276
105	G	A	-1.9517
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2448
110	I	A	0.4190
111	V	A	1.2501
112	N	A	-0.4221
113	N	A	-1.8458
114	T	A	-1.7350
115	E	A	-2.9633
116	G	A	-2.6575
117	D	A	-2.7598
118	W	A	-1.4156
119	W	A	-0.7714
120	L	A	0.3721
121	A	A	0.0000
122	H	A	-0.3839
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4944
130	G	A	0.0000
131	Y	A	0.1832
132	I	A	0.0000
133	P	A	-0.6438
134	N	A	-1.4800	mutated: SA134N
135	N	A	-1.3113
136	Y	A	-0.1773
137	V	A	0.0000
138	A	A	-0.0332
139	P	A	-0.1471
140	S	A	-0.1735