Project name: PLN_Renee_Maas

Status: done

submitted: 2018-11-06 10:40:38, status changed: 2018-11-06 10:47:28
Settings
Chain sequence(s) A: MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILIFLLLICIIVMLL
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.2893
Maximal score value
5.9407
Average score
1.2361
Total score value
64.276

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.0441
2 D A -1.6817
3 K A -1.3299
4 V A 0.2780
5 Q A -0.8369
6 Y A 0.3109
7 L A 0.8646
8 T A -0.2278
9 R A -1.5320
10 S A -1.1146
11 A A -0.2290
12 I A -0.1615
13 R A -2.4827
14 R A -2.5701
15 A A -1.1611
16 S A -0.8458
17 T A -1.1378
18 I A -0.3840
19 E A -1.5588
20 M A -1.0925
21 P A -1.4871
22 Q A -2.5235
23 Q A -2.5372
24 A A -2.1324
25 R A -3.2428
26 Q A -3.2893
27 N A -2.5176
28 L A -0.1851
29 Q A -0.9481
30 N A -0.2132
31 L A 2.4355
32 F A 3.3693
33 I A 3.2821
34 N A 2.2001
35 F A 4.6034
36 C A 4.3879
37 L A 4.7463
38 I A 5.4358
39 L A 5.4200
40 I A 5.7169
41 F A 5.9407
42 L A 5.4848
43 L A 5.1470
44 L A 4.6920
45 I A 4.8583
46 C A 4.7805
47 I A 4.6835
48 I A 5.4363
49 V A 5.0911
50 M A 4.3133
51 L A 4.3345
52 L A 3.9298

 

Laboratory of Theory of Biopolymers 2015