Project name: SH3_T129P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA129P
Energy difference between WT (input) and mutated protein (by FoldX)	1.21945 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.7952
• Average score: -0.9226
• Total score value: -55.358

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4981
82	S	A	-0.6755
83	H	A	-0.7862
84	M	A	0.2759
85	T	A	0.0000
86	F	A	-0.0928
87	V	A	-0.6163
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1552
97	E	A	-2.3537
98	T	A	-1.2729
99	D	A	-1.3546
100	L	A	0.0000
101	S	A	-1.9238
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0034
108	L	A	0.0000
109	Q	A	-0.3258
110	I	A	0.2105
111	V	A	0.7952
112	N	A	-0.6176
113	N	A	-1.9047
114	T	A	-1.7769
115	E	A	-2.9329
116	G	A	-2.6068
117	D	A	-2.6855
118	W	A	-1.3424
119	W	A	-0.7897
120	L	A	0.2149
121	A	A	0.0000
122	H	A	-0.5822
123	S	A	0.0000
124	L	A	-0.0838
125	T	A	-0.6788
126	T	A	-0.8470
127	G	A	-0.8127
128	Q	A	-1.4560
129	P	A	-0.7278	mutated: TA129P
130	G	A	0.0000
131	Y	A	0.1107
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2867
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1457
140	S	A	-0.1759