Project name: SH3_Y92N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92N
Energy difference between WT (input) and mutated protein (by FoldX)	3.78186 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5983
• Maximal score value: 1.2498
• Average score: -0.9706
• Total score value: -58.238

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1008
87	V	A	-0.6168
88	A	A	0.0000
89	L	A	-0.3514
90	Y	A	-0.8352
91	D	A	-3.0684
92	N	A	-2.5783	mutated: YA92N
93	E	A	-3.1320
94	S	A	-2.3351
95	R	A	-2.8611
96	T	A	-2.1922
97	E	A	-2.3853
98	T	A	-1.2931
99	D	A	-1.4738
100	L	A	0.0000
101	S	A	-2.0824
102	F	A	0.0000
103	K	A	-3.5983
104	K	A	-2.9295
105	G	A	-1.9610
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4084
113	N	A	-1.7966
114	T	A	-1.7206
115	E	A	-2.9122
116	G	A	-2.5871
117	D	A	-2.6486
118	W	A	-1.2728
119	W	A	-0.6722
120	L	A	0.4055
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4221
129	T	A	-0.5125
130	G	A	0.0000
131	Y	A	0.1934
132	I	A	0.0000
133	P	A	-0.5917
134	S	A	-1.2591
135	N	A	-1.2275
136	Y	A	-0.2396
137	V	A	0.0000
138	A	A	-0.0145
139	P	A	-0.1505
140	S	A	-0.1759