Project name: SH3_L120I

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120I
Energy difference between WT (input) and mutated protein (by FoldX)	3.38138 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4774
• Maximal score value: 1.2709
• Average score: -0.8878
• Total score value: -53.2656

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4522
82	S	A	-0.6843
83	H	A	-0.7924
84	M	A	0.2647
85	T	A	0.0000
86	F	A	-0.1075
87	V	A	-0.6206
88	A	A	0.0000
89	L	A	-0.2999
90	Y	A	-0.7095
91	D	A	-2.8409
92	Y	A	-2.1029
93	E	A	-2.8836
94	S	A	0.0000
95	R	A	-2.7844
96	T	A	-2.1834
97	E	A	-2.3822
98	T	A	-1.2946
99	D	A	-1.4231
100	L	A	0.0000
101	S	A	-1.9414
102	F	A	0.0000
103	K	A	-3.4774
104	K	A	-2.8504
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0746
108	L	A	0.0000
109	Q	A	-0.2408
110	I	A	0.4423
111	V	A	1.2709
112	N	A	-0.3361
113	N	A	-1.7079
114	T	A	-1.5712
115	E	A	-2.6331
116	G	A	-2.4749
117	D	A	-2.6504
118	W	A	-1.3494
119	W	A	-0.6675
120	I	A	0.4499	mutated: LA120I
121	A	A	0.0000
122	H	A	-0.4016
123	S	A	0.0000
124	L	A	-0.2837
125	T	A	-0.7811
126	T	A	-0.8791
127	G	A	-0.8187
128	Q	A	-1.4146
129	T	A	-0.5284
130	G	A	0.0000
131	Y	A	0.0009
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2864
135	N	A	-1.2533
136	Y	A	-0.2046
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1516
140	S	A	-0.1759