Project name: Mutant_aggregation

Status: done

submitted: 2018-12-19 15:53:09, status changed: 2018-12-19 15:58:00
Settings
Chain sequence(s) A: PTITGNLENQTTSIGESIEVSCTASPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACCAKVEAFFIIEG
Distance of aggregation 5 Å
Dynamic mode No
Mutated residues IA669V
Energy difference between WT (input) and mutated protein (by FoldX) 0.81954 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-2.4035
Maximal score value
1.4794
Average score
-0.5443
Total score value
-44.6301

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
667 P A -0.2670
668 T A -0.0670
669 V A 0.2539 mutated: IA669V
670 T A -0.1026
671 G A -0.7121
672 N A -1.3584
673 L A 0.0000
674 E A -2.0610
675 N A -1.5865
676 Q A -0.5913
677 T A -0.0386
678 T A -0.0589
679 S A -0.2110
680 I A 0.9753
681 G A -0.6356
682 E A -2.0711
683 S A -0.6886
684 I A 0.0000
685 E A -1.8207
686 V A 0.0000
687 S A -0.1088
688 C A 0.0000
689 T A -0.0328
690 A A 0.0029
691 S A -0.2113
696 P A -0.4746
697 Q A -1.2451
698 I A 0.0000
699 M A 0.3228
700 W A 0.0000
701 F A 0.0035
702 K A -0.5753
703 D A -2.0804
704 N A -1.9525
705 E A -2.0513
706 T A -0.3608
707 L A 0.5010
708 V A 1.4794
709 E A -1.7593
710 D A -1.7829
711 S A -0.4918
712 G A -0.2783
713 I A 0.0000
714 V A 0.4680
715 L A -0.0575
716 K A -2.0988
717 D A -2.1978
718 G A -0.9064
719 N A -0.9067
720 R A -1.0646
721 N A -0.8108
722 L A 0.0000
723 T A -0.2302
724 I A 0.0000
725 R A -2.2020
726 R A -2.4035
727 V A 0.0000
728 R A -1.5262
729 K A -2.2133
730 E A -2.1561
731 D A -0.5896
732 E A -0.5387
733 G A 0.0000
734 L A 0.4865
735 Y A 0.0000
736 T A 0.0000
737 C A 0.0000
738 Q A -0.3672
739 A A 0.0000
740 C A 0.8337
745 C A 0.8351
746 A A -0.2094
747 K A -1.6237
748 V A -0.1689
749 E A -1.7270
750 A A 0.0000
751 F A 0.7840
752 F A 0.0000
753 I A 0.8173
754 I A 0.0000
755 E A -1.9265
756 G A -0.7930

 

Laboratory of Theory of Biopolymers 2015