Project name: SH3_Y131G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA131G
Energy difference between WT (input) and mutated protein (by FoldX)	2.4796 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4761
• Maximal score value: 1.0285
• Average score: -0.9347
• Total score value: -56.0804

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2993
90	Y	A	-0.7082
91	D	A	-2.8384
92	Y	A	-2.1006
93	E	A	-2.8848
94	S	A	0.0000
95	R	A	-2.7887
96	T	A	-2.2238
97	E	A	-2.4224
98	T	A	-1.3593
99	D	A	-1.5196
100	L	A	0.0000
101	S	A	-1.9864
102	F	A	0.0000
103	K	A	-3.4761
104	K	A	-2.8496
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2683
110	I	A	0.3070
111	V	A	1.0285
112	N	A	-0.8938
113	N	A	-2.0288
114	T	A	-1.8291
115	E	A	-2.9467
116	G	A	-2.6187
117	D	A	-2.6680
118	W	A	-1.3447
119	W	A	-0.8188
120	L	A	0.3101
121	A	A	0.0000
122	H	A	-0.4535
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4146
129	T	A	-0.5485
130	G	A	0.0000
131	G	A	-0.2423	mutated: YA131G
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2719
135	N	A	-1.2249
136	Y	A	-0.1830
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759