Project name: SH3_N112L

Status: done

submitted: 2019-03-14 15:26:21, status changed: 2019-03-14 17:15:04
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues NA112L
Energy difference between WT (input) and mutated protein (by FoldX) 0.0940586 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.4472
Average score
-0.83
Total score value
-49.7976

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.5157
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1529
97 E A -2.3514
98 T A -1.2471
99 D A -1.3286
100 L A 0.0000
101 S A -1.9020
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2191
110 I A 0.5965
111 V A 1.4472
112 L A 0.8310 mutated: NA112L
113 N A -1.2047
114 T A -1.3492
115 E A -2.6793
116 G A -2.4543
117 D A -2.6823
118 W A -1.1490
119 W A -0.3593
120 L A 0.7431
121 A A 0.0000
122 H A -0.3529
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.5716
130 G A 0.0000
131 Y A 0.3471
132 I A 0.0000
133 P A 0.0000
134 S A -1.2916
135 N A -1.2482
136 Y A -0.2037
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015