Project name: 4dec18 [mutate: VA156A]

Chain sequence(s)	A: QDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVR
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	VA156A
Energy difference between WT (input) and mutated protein (by FoldX)	1.78202 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4209
• Maximal score value: 0.3793
• Average score: -1.0047
• Total score value: -155.7209

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
23	Q	A	-1.6302
24	D	A	-1.9346
25	F	A	0.0000
26	Y	A	0.0000
27	D	A	-2.2365
28	F	A	-1.5781
29	K	A	-1.7888
30	A	A	0.0000
31	V	A	-0.0463
32	N	A	-1.0855
33	I	A	0.0000
34	R	A	-2.8268
35	G	A	-1.9557
36	K	A	-1.5044
37	L	A	0.3793
38	V	A	-0.3764
39	S	A	-1.4991
40	L	A	0.0000
41	E	A	-3.2490
42	K	A	-2.9908
43	Y	A	0.0000
44	R	A	-2.5866
45	G	A	-1.7479
46	S	A	0.0000
47	V	A	0.0000
48	S	A	0.0000
49	L	A	0.0000
50	V	A	0.0000
51	V	A	0.0000
52	N	A	0.0000
53	V	A	0.0000
54	A	A	0.0000
55	S	A	-1.6183
56	E	A	-2.5250
57	C	A	0.0000
58	G	A	-0.9949
59	F	A	-0.5158
60	T	A	0.0000
61	D	A	-2.2713
62	Q	A	-2.2054
63	H	A	0.0000
64	Y	A	0.0000
65	R	A	-2.8199
66	A	A	-2.3076
67	L	A	0.0000
68	Q	A	0.0000
69	Q	A	-2.6543
70	L	A	0.0000
71	Q	A	-2.0726
72	R	A	-3.0099
73	D	A	-2.4896
74	L	A	0.0000
75	G	A	-1.8107
76	P	A	-1.6670
77	H	A	-1.9929
78	H	A	-1.8550
79	F	A	0.0000
80	N	A	-0.8661
81	V	A	0.0000
82	L	A	0.0000
83	A	A	0.0000
84	F	A	0.0000
85	P	A	0.0000
86	C	A	0.0000
87	N	A	-1.6778
88	Q	A	-1.2697
89	F	A	-0.7824
90	G	A	-1.4404
91	Q	A	-2.3049
92	Q	A	-2.1562
93	E	A	0.0000
94	P	A	-2.1482
95	D	A	-3.0062
96	S	A	-2.4252
97	N	A	-2.9427
98	K	A	-3.4209
99	E	A	-2.9565
100	I	A	0.0000
101	E	A	0.0000
102	S	A	-1.6177
103	F	A	-1.0468
104	A	A	0.0000
105	R	A	-1.5548
106	R	A	-2.0210
107	T	A	-1.3422
108	Y	A	-1.4133
109	S	A	-1.1898
110	V	A	0.0000
111	S	A	-0.8427
112	F	A	0.0000
113	P	A	-0.1969
114	M	A	0.0000
115	F	A	0.0000
116	S	A	-1.0330
117	K	A	-0.8134
118	I	A	-0.1258
119	A	A	-0.5363
120	V	A	0.0000
121	T	A	-0.9874
122	G	A	-1.0838
123	T	A	-0.7140
124	G	A	-0.7944
125	A	A	0.0000
126	H	A	-0.8114
127	P	A	-0.9144
128	A	A	0.0000
129	F	A	0.0000
130	K	A	-1.8709
131	Y	A	-1.4163
132	L	A	0.0000
133	A	A	-2.1949
134	Q	A	-2.1822
135	T	A	-1.4473
136	S	A	-1.5328
137	G	A	-1.8953
138	K	A	-2.7002
139	E	A	-2.8153
140	P	A	0.0000
141	T	A	-0.5885
142	W	A	-0.0467
143	N	A	0.0000
144	F	A	0.0000
145	W	A	0.0000
146	K	A	0.0000
147	Y	A	0.0000
148	L	A	0.0000
149	V	A	0.0000
150	A	A	-0.9577
151	P	A	-1.5105
152	D	A	-2.4868
153	G	A	0.0000
154	K	A	-1.9514
155	V	A	-0.6712
156	A	A	-0.2200	mutated: VA156A
157	G	A	-0.3493
158	A	A	-0.5360
159	W	A	-0.5943
160	D	A	-0.6761
161	P	A	0.0000
162	T	A	0.0557
163	V	A	-0.5834
164	S	A	-1.4393
165	V	A	-2.0909
166	E	A	-2.9865
167	E	A	-3.0110
168	V	A	0.0000
169	R	A	-2.3516
170	P	A	-1.6138
171	Q	A	-1.3503
172	I	A	0.0000
173	T	A	-0.7200
174	A	A	-0.2867
175	L	A	0.0717
176	V	A	-0.9167
177	R	A	-1.9505