Project name: query_structure

Status: done

Started: 2025-11-29 10:21:28
Settings
Chain sequence(s) B: GFPCGESCVYIPCFTAAIGCSSCKSKVCYKN
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:28)
Show buried residues

Minimal score value
-1.9647
Maximal score value
2.9968
Average score
0.2715
Total score value
8.1435

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B -0.6490
2 F B 1.0158
3 P B 0.1062
4 C B 0.3475
5 G B -0.3424
6 E B -0.3412
7 S B 0.0258
8 C B 0.0000
9 V B 1.6319
10 Y B 2.5472
11 I B 2.9968
12 P B 1.6256
13 C B 0.0000
14 F B 2.3378
15 T B 1.3073
16 A B 1.1390
17 A B 1.4340
18 I B 1.9861
19 G B 0.4201
20 C B 0.0000
21 S B -0.4474
22 C B -0.4783
23 K B -1.9647
24 S B -1.3894
25 K B -1.2582
26 V B -0.6253
27 C B 0.0000
28 Y B -0.7248
29 K B -1.0796
30 N B -1.4773
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018