Project name: igf

Chain sequence(s)	A: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSAHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:21)

• Minimal score value: -3.0656
• Maximal score value: 2.9079
• Average score: -0.5963
• Total score value: -53.0672

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.9444
2	F	A	2.4878
3	P	A	1.2851
4	A	A	1.2846
5	M	A	1.6152
6	P	A	0.9166
7	L	A	1.8319
8	S	A	1.3259
9	S	A	1.6287
10	L	A	2.9079
11	F	A	2.7464
12	V	A	2.0397
13	N	A	-0.3500
14	G	A	-0.8500
15	P	A	-1.6340
16	R	A	-2.0154
17	T	A	-0.5841
18	L	A	0.0000
19	C	A	0.6163
20	G	A	-0.3018
21	A	A	-0.9721
22	E	A	-1.6035
23	L	A	0.0000
24	V	A	-0.5359
25	D	A	-1.8912
26	A	A	0.0000
27	L	A	0.0000
28	Q	A	-1.3380
29	F	A	0.6098
30	V	A	-0.0947
31	C	A	0.0000
32	G	A	-1.4032
33	D	A	-2.0382
34	R	A	-1.5844
35	G	A	-0.6708
36	F	A	0.0013
37	Y	A	0.6616
38	F	A	0.6930
39	N	A	-1.3258
40	K	A	-1.5889
41	P	A	-1.1204
42	T	A	-0.9187
43	G	A	-0.5353
44	Y	A	0.2444
45	G	A	-0.2519
46	S	A	-0.5930
47	S	A	-1.1962
48	S	A	-1.8328
49	R	A	-2.9476
50	R	A	-3.0656
51	A	A	-1.8144
52	P	A	-1.6607
53	Q	A	-2.1737
54	T	A	-1.0883
55	G	A	-0.8836
56	I	A	0.0000
57	V	A	0.4380
58	D	A	-0.2402
59	E	A	-0.6876
60	C	A	0.0000
61	C	A	0.0653
62	F	A	0.7631
63	R	A	-1.4509
64	S	A	-1.5541
65	C	A	-1.6480
66	D	A	-2.3903
67	L	A	-1.0696
68	R	A	-2.3208
69	R	A	-1.9723
70	L	A	0.0000
71	E	A	-1.0767
72	M	A	-0.1330
73	Y	A	0.0000
74	C	A	0.0000
75	A	A	0.0000
76	P	A	-0.0867
77	L	A	-0.2009
78	K	A	-1.5505
79	P	A	-1.1385
80	A	A	-1.1841
81	K	A	-2.1800
82	S	A	-1.6307
83	A	A	-1.6923
84	H	A	-2.2983
85	H	A	-2.3178
86	H	A	-2.6303
87	H	A	-2.5682
88	H	A	-2.4182
89	H	A	-1.8700