Project name: 101315795d66063

Status: done

submitted: 2026-04-09 10:46:59, status changed: 2026-04-09 19:54:35

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence RRRVQLFPGSNDARRRH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 46.4929 2.15087 6.61546 100
cluster_2.pdb ( medoid) 19.7244 6.38803 35.4756 126
cluster_3.pdb ( medoid) 17.573 6.25962 22.7993 110
cluster_4.pdb ( medoid) 12.9559 8.1044 21.921 105
cluster_5.pdb ( medoid) 12.7337 9.97357 31.799 127
cluster_6.pdb ( medoid) 7.04817 11.3505 29.652 80
cluster_7.pdb ( medoid) 6.39618 13.2892 36.5792 85
cluster_8.pdb ( medoid) 4.86383 13.7752 30.4439 67
cluster_9.pdb ( medoid) 4.67819 14.3218 31.3536 67
cluster_10.pdb ( medoid) 2.32056 14.2207 31.4439 33