Project name: 1107af065dcd8e3

Status: done

submitted: 2026-04-01 07:54:34, status changed: 2026-04-01 08:38:54

Project settings
Protein sequence(s) MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence TRCVLPSSPRLW
Simulation mc cycles5
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 120.104 0.832609 2.43026 100
cluster_2.pdb ( medoid) 43.0856 2.39059 28.693 103
cluster_3.pdb ( medoid) 18.6951 5.88391 17.8646 110
cluster_4.pdb ( medoid) 17.5142 8.45028 29.7522 148
cluster_5.pdb ( medoid) 12.4107 9.26618 29.132 115
cluster_6.pdb ( medoid) 9.84542 11.3758 36.5 112
cluster_7.pdb ( medoid) 7.75295 11.4795 23.9573 89
cluster_8.pdb ( medoid) 6.55047 16.4874 31.4028 108
cluster_9.pdb ( medoid) 6.1044 7.53554 24.0264 46
cluster_10.pdb ( medoid) 3.92202 17.593 32.8632 69