CABS-dock: 112300a00954830

Project name: 112300a00954830

Status: done

submitted: 2026-01-21 23:09:53, status changed: 2026-01-22 01:36:30

Project settings

Protein sequence(s)	RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP input pdb
Peptide sequence	SEAEELRKLNELREKEVRLS
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHHHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.6476	5.75111	19.4684	136
cluster_2.pdb ( medoid)	23.5831	6.19087	31.7855	146
cluster_3.pdb ( medoid)	17.3	7.10983	23.656	123
cluster_4.pdb ( medoid)	14.4179	9.36334	32.692	135
cluster_5.pdb ( medoid)	14.3226	10.6824	31.4531	153
cluster_6.pdb ( medoid)	13.5455	8.71138	34.2306	118
cluster_7.pdb ( medoid)	10.9008	5.96287	14.6341	65
cluster_8.pdb ( medoid)	7.9844	6.63794	12.4556	53
cluster_9.pdb ( medoid)	4.26144	10.0905	27.7507	43
cluster_10.pdb ( medoid)	3.34472	8.37141	17.6525	28