Project name: 3IEC_third_Sequence

Status: done

submitted: 2026-04-19 12:58:04, status changed: 2026-04-19 14:20:29

Project settings
Protein sequence(s) HIGNYRLLKTIGAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGWMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY input pdb
Peptide sequence AWKEKIRKKLKNEIKKKGRKAVIAW
Simulation mc cycles5
Peptide secondary structure psipred CHHHHHHHHHHHHHHHHCCCHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.3238 3.19246 5.39809 100
cluster_2.pdb ( medoid) 28.4382 3.51639 11.1033 100
cluster_3.pdb ( medoid) 17.3092 5.77726 11.413 100
cluster_4.pdb ( medoid) 13.7843 9.72124 56.4479 134
cluster_5.pdb ( medoid) 10.0778 11.1135 34.5031 112
cluster_6.pdb ( medoid) 9.7668 12.7985 53.3577 125
cluster_7.pdb ( medoid) 9.46707 13.2037 39.255 125
cluster_8.pdb ( medoid) 7.13366 12.3359 30.0931 88
cluster_9.pdb ( medoid) 4.42047 13.7994 47.3183 61
cluster_10.pdb ( medoid) 3.20882 17.1403 33.5329 55