CABS-dock: C-H-143

Project name: C-H-143_4

Status: done

submitted: 2025-02-04 08:26:45, status changed: 2025-02-04 21:27:42

Project settings

Protein sequence(s)

MNMNVLVLCFVLSVSAEGLHVDRQVIGCSDHDGEQAYNLDGEEMWFADFIKREGVEPQPPFIDHITYVDGTYQGAEANQHVCKSNLDVSRTAMKDFKIEDEPPSSPMIYTRDAVELGGENTLICHVTGFYPAPVHVYWTKNGVDVTEGTSLNVPYPNTDGSFRQTARLKFIAQQGDVYSCTVSHLALDQSLTKIWDVDVQQPSVGPAVFCGVGLSVGLLGVAAGTFFLIKGNECSMASFILSFSLFFITVCTANGFRYYVVNSCEFNSSKLNDIEFTESYYYNKLEYIRFSSSVGKFVGYTEHGIKNAERWNNGPEVISSRGEKERYCLNNVGVDVESALTNTQTLRQASLCGAPSWQTCMLVCSVFDFYPKRIKVSWQRDGQEVTSDVTSTDELADGDWYYQIHSHLEYMPKSGEKISCVVEHASLSKPLITDWDPSMPESERNKIAIGTSGLILGLTLSLAGFIYYKRKAQGRILVPTN input pdb

Peptide sequence

GSDQYNLKLSKQRAQ

Simulation mc cycles

Peptide secondary structure psipred

CCCHHHHHHHHHHCC

Flexible regions

108:B - 18:B

100:A - 19:A

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	91.0907	1.24052	7.20337	113
cluster_2.pdb ( medoid)	26.6304	3.86777	19.9662	103
cluster_3.pdb ( medoid)	16.4973	8.18318	34.809	135
cluster_4.pdb ( medoid)	14.6722	6.20221	17.6889	91
cluster_5.pdb ( medoid)	14.1002	9.78707	47.2324	138
cluster_6.pdb ( medoid)	13.0862	4.81422	10.3699	63
cluster_7.pdb ( medoid)	11.59	8.80068	45.445	102
cluster_8.pdb ( medoid)	10.5435	6.5443	24.655	69
cluster_9.pdb ( medoid)	9.84255	7.11198	31.5894	70
cluster_10.pdb ( medoid)	4.59281	16.1121	44.4102	74