Project name: YWHAG_ABI3_D225_1433

Status: done

submitted: 2025-04-13 00:24:24, status changed: 2025-04-13 14:32:42

Project settings
Protein sequence(s) MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN input pdb
Peptide sequence GVGGAPDPKGQ
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.8665 8.89957 33.643 248
cluster_2.pdb ( medoid) 24.3023 4.15599 12.048 101
cluster_3.pdb ( medoid) 22.8257 4.46865 27.1995 102
cluster_4.pdb ( medoid) 21.0193 4.18662 10.1991 88
cluster_5.pdb ( medoid) 18.2811 6.61886 19.9341 121
cluster_6.pdb ( medoid) 14.9189 5.89858 28.1343 88
cluster_7.pdb ( medoid) 12.2341 6.94777 25.7096 85
cluster_8.pdb ( medoid) 12.2282 7.27828 21.5149 89
cluster_9.pdb ( medoid) 3.741 9.8904 25.0896 37
cluster_10.pdb ( medoid) 3.66496 11.187 29.5488 41