CABS-dock: 124a1d93fe55427

Project name: 124a1d93fe55427

Status: done

submitted: 2026-06-10 08:52:28, status changed: 2026-06-10 13:15:13

Project settings

Protein sequence(s)	MKLFVVLACLAAPGTFPFVDAATVIPANSFSSFSTYWNNFYPWGTDHNGSGRMASANIIVASNTLSLIATPTSNPSPPTSTSNPKPAIHYASGAIHAKEHITVTAANAYTVSGEFSAPTAVGTWPAFWLTAVSGWPPEVDIGEWKGTADNWFNTFNTSSVVKSTLVDWPTDLSFHSVKAVLTAQSNNKDVKIDFYMDNKFIVTQYGSGFVGKAMYLIINLQMEGSSGSPGPSGRTVYKARNVQVTRTGN input pdb
Peptide sequence	SFGDGAF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	51.6263	2.32439	26.2762	120
cluster_2.pdb ( medoid)	48.3768	2.48053	13.284	120
cluster_3.pdb ( medoid)	31.978	3.47113	10.1331	111
cluster_4.pdb ( medoid)	24.4116	8.19282	23.0325	200
cluster_5.pdb ( medoid)	24.3499	3.08009	10.2615	75
cluster_6.pdb ( medoid)	18.6053	8.00845	36.5731	149
cluster_7.pdb ( medoid)	11.0234	4.89867	13.5597	54
cluster_8.pdb ( medoid)	9.09691	6.37579	12.2191	58
cluster_9.pdb ( medoid)	6.30695	10.3061	28.8494	65
cluster_10.pdb ( medoid)	4.66826	10.2822	23.2468	48