CABS-dock: braf_monomer_peptide

Project name: braf_monomer_peptide_6

Status: done

submitted: 2025-12-28 10:29:40, status changed: 2025-12-28 17:22:23

Project settings

Protein sequence(s)	DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYKHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRRDLKSNNIFLHEDNNTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAEECLKKKRDERPSFPRILAEIEELARE input pdb
Peptide sequence	TRHVNILLFM
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	54.4014	2.81243	18.3972	153
cluster_2.pdb ( medoid)	39.0333	7.30145	26.0862	285
cluster_3.pdb ( medoid)	27.3714	4.20146	18.2973	115
cluster_4.pdb ( medoid)	19.1693	5.84268	14.7125	112
cluster_5.pdb ( medoid)	14.9191	4.69197	13.4662	70
cluster_6.pdb ( medoid)	9.73669	12.9407	38.0377	126
cluster_7.pdb ( medoid)	5.80002	6.03446	18.0618	35
cluster_8.pdb ( medoid)	3.72319	12.6236	28.7369	47
cluster_9.pdb ( medoid)	3.64292	11.5292	26.2303	42
cluster_10.pdb ( medoid)	1.38324	10.8441	24.5243	15