CABS-dock: 12b16a2b929a2b8

Project name: 12b16a2b929a2b8

Status: done

submitted: 2026-05-08 12:29:22, status changed: 2026-05-08 15:55:00

Project settings

Protein sequence(s)	RDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF input pdb
Peptide sequence	CKFHY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.2042	3.73446	13.8668	124
cluster_2.pdb ( medoid)	32.0078	3.87405	27.5032	124
cluster_3.pdb ( medoid)	31.9918	7.59571	27.7761	243
cluster_4.pdb ( medoid)	27.9171	4.01188	29.5366	112
cluster_5.pdb ( medoid)	11.996	5.25176	19.2336	63
cluster_6.pdb ( medoid)	11.6889	5.81747	21.969	68
cluster_7.pdb ( medoid)	7.92345	7.19384	26.4755	57
cluster_8.pdb ( medoid)	6.6277	13.1267	29.7379	87
cluster_9.pdb ( medoid)	5.74716	11.4839	30.3732	66
cluster_10.pdb ( medoid)	4.25444	13.1627	31.4316	56