Project name: 12bce929ae9c341

Status: done

submitted: 2026-07-27 05:29:45, status changed: 2026-07-27 07:22:01

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRIVQVQCGSNKKR
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.0835 6.06493 30.7459 140
cluster_2.pdb ( medoid) 19.6399 6.87375 24.5648 135
cluster_3.pdb ( medoid) 17.5908 7.90184 32.1224 139
cluster_4.pdb ( medoid) 9.90528 12.5186 26.8793 124
cluster_5.pdb ( medoid) 7.63568 13.6203 25.5523 104
cluster_6.pdb ( medoid) 7.14939 14.5467 39.9521 104
cluster_7.pdb ( medoid) 5.23431 14.9017 32.2017 78
cluster_8.pdb ( medoid) 4.44936 14.3841 35.0903 64
cluster_9.pdb ( medoid) 3.73278 16.0738 32.097 60
cluster_10.pdb ( medoid) 3.02422 17.1945 36.6513 52