Project name: 132df2fb6539aa1

Status: done

submitted: 2026-04-14 05:30:09, status changed: 2026-04-14 08:21:38

Project settings
Protein sequence(s) MEEQDRIAILQQFGRTYRAFMSAFEAHVGQPLPRWRIMVALEQHGGASSQKRLVELLRVDPGALTRQLKTLETLGWIDREADARDNRVTNVRLTQAGRAAFEACLPRRNAFLHDTMASLPDDVLSALSGALTMLEARVAEVGAK input pdb
Peptide sequence DALEIYVDDEK
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 44.8657 3.5662 9.42518 160
cluster_2.pdb ( medoid) 39.8952 5.26379 10.2079 210
cluster_3.pdb ( medoid) 29.5461 4.26452 12.2865 126
cluster_4.pdb ( medoid) 26.4327 2.87523 10.6831 76
cluster_5.pdb ( medoid) 22.7854 3.11604 8.22649 71
cluster_6.pdb ( medoid) 19.493 5.43784 12.9198 106
cluster_7.pdb ( medoid) 15.9467 3.82525 9.52334 61
cluster_8.pdb ( medoid) 14.4467 6.02214 11.438 87
cluster_9.pdb ( medoid) 11.1803 5.81382 10.8394 65
cluster_10.pdb ( medoid) 10.8498 3.50236 7.76561 38