CABS-dock: 1382e5348d222bd

Project name: 1382e5348d222bd

Status: done

submitted: 2026-07-27 14:06:39, status changed: 2026-07-27 16:11:03

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRIVQVQCGSNCKR
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.629	4.88618	22.7115	135
cluster_2.pdb ( medoid)	16.9547	7.31362	27.6068	124
cluster_3.pdb ( medoid)	11.9115	12.341	31.969	147
cluster_4.pdb ( medoid)	10.8759	11.2175	30.7046	122
cluster_5.pdb ( medoid)	8.94165	13.1967	27.9583	118
cluster_6.pdb ( medoid)	6.92731	11.4041	29.9437	79
cluster_7.pdb ( medoid)	6.52325	13.3369	28.5404	87
cluster_8.pdb ( medoid)	6.12316	10.7788	24.2033	66
cluster_9.pdb ( medoid)	5.03434	15.2949	31.5252	77
cluster_10.pdb ( medoid)	4.02075	11.192	28.077	45