Project name: 1382e5348d222bd

Status: done

submitted: 2026-07-27 14:06:39, status changed: 2026-07-27 16:11:03

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRIVQVQCGSNCKR
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.629 4.88618 22.7115 135
cluster_2.pdb ( medoid) 16.9547 7.31362 27.6068 124
cluster_3.pdb ( medoid) 11.9115 12.341 31.969 147
cluster_4.pdb ( medoid) 10.8759 11.2175 30.7046 122
cluster_5.pdb ( medoid) 8.94165 13.1967 27.9583 118
cluster_6.pdb ( medoid) 6.92731 11.4041 29.9437 79
cluster_7.pdb ( medoid) 6.52325 13.3369 28.5404 87
cluster_8.pdb ( medoid) 6.12316 10.7788 24.2033 66
cluster_9.pdb ( medoid) 5.03434 15.2949 31.5252 77
cluster_10.pdb ( medoid) 4.02075 11.192 28.077 45