CABS-dock: 14010f4080abd11

Project name: 14010f4080abd11

Status: done

submitted: 2026-04-19 13:39:34, status changed: 2026-04-19 16:31:23

Project settings

Protein sequence(s)	DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENAEANRFMESVLPTLWMLKDYALQSGAGLAFE input pdb
Peptide sequence	GLLKKIKWLL
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.5459	7.79781	28.453	207
cluster_2.pdb ( medoid)	20.9379	6.78196	24.0403	142
cluster_3.pdb ( medoid)	20.8468	5.27659	28.6166	110
cluster_4.pdb ( medoid)	20.4601	6.94034	41.0881	142
cluster_5.pdb ( medoid)	16.6996	6.22769	28.4582	104
cluster_6.pdb ( medoid)	16.611	5.29771	11.634	88
cluster_7.pdb ( medoid)	9.56644	6.1674	12.287	59
cluster_8.pdb ( medoid)	5.7327	8.89633	19.604	51
cluster_9.pdb ( medoid)	4.50931	13.9711	33.6212	63
cluster_10.pdb ( medoid)	3.78622	8.97992	16.3695	34