Project name: cabs-dock-test1

Status: done

submitted: 2026-07-23 01:59:05, status changed: 2026-07-23 03:29:24

Project settings
Protein sequence(s) STPHLVNLNEDPLMSECLLYHIKDGVTRVGQVDMDIKLTGQFIREQHCLFRSIPQPDGEVVVTLEPCEGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNH input pdb
Peptide sequence EHGAPEDENR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.9713 4.75487 25.2254 133
cluster_2.pdb ( medoid) 24.3434 5.50456 24.2415 134
cluster_3.pdb ( medoid) 15.2472 7.21444 15.7587 110
cluster_4.pdb ( medoid) 14.5816 12.2757 29.7698 179
cluster_5.pdb ( medoid) 13.8105 7.60291 30.1625 105
cluster_6.pdb ( medoid) 13.5334 5.91129 19.9095 80
cluster_7.pdb ( medoid) 7.65711 10.3172 21.6321 79
cluster_8.pdb ( medoid) 6.45611 10.8424 23.4934 70
cluster_9.pdb ( medoid) 4.75064 14.1034 27.1823 67
cluster_10.pdb ( medoid) 3.53822 12.153 24.3316 43