Project name: LexA-Cs5

Status: done

submitted: 2026-01-10 14:46:04, status changed: 2026-01-10 18:01:45

Project settings
Protein sequence(s) EEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVVIRNGDWL input pdb
Peptide sequence QAIIHNEKVQAHGKKVL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCHHHHHCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.6498 5.92875 26.181 158
cluster_2.pdb ( medoid) 22.0587 7.97871 33.7933 176
cluster_3.pdb ( medoid) 15.903 9.43219 29.1331 150
cluster_4.pdb ( medoid) 15.2769 4.12388 11.6033 63
cluster_5.pdb ( medoid) 14.8423 8.69137 23.0186 129
cluster_6.pdb ( medoid) 11.9932 7.58762 18.3632 91
cluster_7.pdb ( medoid) 7.12311 8.70406 27.6674 62
cluster_8.pdb ( medoid) 6.18557 12.7717 34.0973 79
cluster_9.pdb ( medoid) 3.69955 12.7043 30.7548 47
cluster_10.pdb ( medoid) 3.69614 12.1749 30.1506 45