CABS-dock: 14a53a7089f6e0e

Project name: 14a53a7089f6e0e

Status: done

submitted: 2026-07-28 09:48:18, status changed: 2026-07-28 11:38:55

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQVFGDNNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.7777	5.16594	30.689	128
cluster_2.pdb ( medoid)	17.7331	6.93618	22.5826	123
cluster_3.pdb ( medoid)	14.9304	7.36752	25.6826	110
cluster_4.pdb ( medoid)	11.0612	9.13101	20.224	101
cluster_5.pdb ( medoid)	9.12977	11.8294	26.5278	108
cluster_6.pdb ( medoid)	8.60985	13.3568	31.2051	115
cluster_7.pdb ( medoid)	7.75708	9.79751	24.183	76
cluster_8.pdb ( medoid)	5.6573	14.8481	35.8945	84
cluster_9.pdb ( medoid)	5.63264	15.8008	36.0763	89
cluster_10.pdb ( medoid)	4.63443	14.2412	34.4963	66