CABS-dock: 1588bf63fe1bfa9

Project name: 1588bf63fe1bfa9

Status: done

submitted: 2026-01-22 13:10:38, status changed: 2026-01-22 14:59:59

Project settings

Protein sequence(s)	GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence	EVNGDFIQKEEDTEQE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.6125	5.52371	25.3517	147
cluster_2.pdb ( medoid)	18.9452	3.32538	14.6091	63
cluster_3.pdb ( medoid)	18.4675	8.17652	30.1669	151
cluster_4.pdb ( medoid)	14.1495	6.714	17.0939	95
cluster_5.pdb ( medoid)	12.5067	9.11509	26.4267	114
cluster_6.pdb ( medoid)	11.0336	5.70984	13.8301	63
cluster_7.pdb ( medoid)	10.2508	10.3406	27.2186	106
cluster_8.pdb ( medoid)	10.0555	11.5359	27.7024	116
cluster_9.pdb ( medoid)	7.82172	13.6799	30.1453	107
cluster_10.pdb ( medoid)	2.89917	13.1072	32.9186	38