CABS-dock: 15b53a3faa2392f

Project name: 15b53a3faa2392f

Status: done

submitted: 2026-07-10 13:50:20, status changed: 2026-07-10 20:35:56

Project settings

Protein sequence(s)	FQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPANRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAFVG input pdb
Peptide sequence	MVTGRLAVTLVGAPGPYVALIKTK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEEEEECCCCCCEEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.5312	5.68322	25.971	111
cluster_2.pdb ( medoid)	18.7034	6.25554	43.3103	117
cluster_3.pdb ( medoid)	18.6105	5.05091	9.73264	94
cluster_4.pdb ( medoid)	15.2314	6.17146	13.8353	94
cluster_5.pdb ( medoid)	13.156	7.06903	26.0569	93
cluster_6.pdb ( medoid)	8.65963	11.5478	37.2385	100
cluster_7.pdb ( medoid)	8.08306	12.8664	41.0977	104
cluster_8.pdb ( medoid)	6.1932	11.6257	49.332	72
cluster_9.pdb ( medoid)	5.20267	17.1066	48.691	89
cluster_10.pdb ( medoid)	5.00303	14.9909	48.6008	75