CABS-dock: 2O2F-GPVGPSGPPGIP

Project name: 2O2F-GPVGPSGPPGIP

Status: done

submitted: 2025-08-24 09:00:21, status changed: 2025-08-24 11:15:49

Project settings

Protein sequence(s)	GYDNREIVMKYIHYKLSQRGYEWDEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP input pdb
Peptide sequence	GPVGPSGPPGIP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.0578	6.48127	19.8961	130
cluster_2.pdb ( medoid)	18.7739	6.7647	43.896	127
cluster_3.pdb ( medoid)	15.0263	10.0491	28.2231	151
cluster_4.pdb ( medoid)	9.35663	12.932	35.1774	121
cluster_5.pdb ( medoid)	8.22631	13.6149	36.2987	112
cluster_6.pdb ( medoid)	7.65253	11.8915	24.1047	91
cluster_7.pdb ( medoid)	6.74656	13.6366	37.5388	92
cluster_8.pdb ( medoid)	6.15711	10.7193	24.4924	66
cluster_9.pdb ( medoid)	5.89891	9.83232	23.7759	58
cluster_10.pdb ( medoid)	2.62931	19.777	49.5841	52