Project name: 161270574887d67

Status: done

submitted: 2026-03-15 13:53:16, status changed: 2026-03-15 20:36:18

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence IKIWFQNRRMKWGGVQVFGSNTY
Simulation mc cycles50
Peptide secondary structure psipred CCEEEECCCCCCCCEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.6206 6.8741 40.2316 128
cluster_2.pdb ( medoid) 15.7801 9.75916 36.559 154
cluster_3.pdb ( medoid) 13.2903 8.1262 23.5813 108
cluster_4.pdb ( medoid) 12.4553 9.1527 26.8181 114
cluster_5.pdb ( medoid) 7.62576 17.8343 43.5561 136
cluster_6.pdb ( medoid) 6.89801 16.3815 36.615 113
cluster_7.pdb ( medoid) 5.94812 14.2902 40.3432 85
cluster_8.pdb ( medoid) 5.78581 11.5801 28.5616 67
cluster_9.pdb ( medoid) 5.19859 7.50203 23.0256 39
cluster_10.pdb ( medoid) 4.68577 11.9511 29.2635 56