CABS-dock: 161f0d2dea0e786

Project name: 161f0d2dea0e786

Status: done

submitted: 2026-01-22 13:18:00, status changed: 2026-01-22 17:20:38

Project settings

Protein sequence(s)	EASRQQQRRFNTSSIRDFEFWLSEAETLLAMKDQQARDLASSAGNLLKKHQLLERREMLAREDALKDLNTLAEDDLLSSSGTTFNVDQIVKKKDNNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEHWEEKLKELAKARGLKLEESLEYLQFMQ input pdb
Peptide sequence	RTAPKRGTVSEEKKHF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.7113	5.02042	25.3077	109
cluster_2.pdb ( medoid)	20.1436	10.5741	25.6944	213
cluster_3.pdb ( medoid)	19.0987	9.11055	36.4571	174
cluster_4.pdb ( medoid)	13.5764	11.4905	28.0744	156
cluster_5.pdb ( medoid)	6.99742	9.43204	29.2947	66
cluster_6.pdb ( medoid)	5.50213	13.4493	33.6922	74
cluster_7.pdb ( medoid)	3.90685	17.4053	45.0769	68
cluster_8.pdb ( medoid)	3.80575	13.138	29.1471	50
cluster_9.pdb ( medoid)	2.99669	16.6851	35.4571	50
cluster_10.pdb ( medoid)	2.49214	16.0505	31.8439	40