CABS-dock: 7NUI_QAIELQ

Project name: 7NUI_QAIELQ_E2

Status: done

submitted: 2026-05-30 16:00:48, status changed: 2026-05-31 15:04:16

Project settings

Protein sequence(s)	GSHSMRYFDTAMSRPGRGEPRFISSVGYVDDTQFVRFDSDAASPRMEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence	QAIELQLTLETIYNSQYSN
Simulation mc cycles	200
Peptide secondary structure psipred	CCEEEEEEHHHHHHCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.7003	2.54406	24.5436	101
cluster_2.pdb ( medoid)	38.049	2.7596	32.8133	105
cluster_3.pdb ( medoid)	35.212	4.5439	9.79662	160
cluster_4.pdb ( medoid)	24.0895	5.10596	30.4254	123
cluster_5.pdb ( medoid)	19.6298	4.07544	10.2898	80
cluster_6.pdb ( medoid)	9.67359	9.20031	29.8401	89
cluster_7.pdb ( medoid)	6.0972	8.85653	40.0998	54
cluster_8.pdb ( medoid)	4.66494	14.7912	33.962	69
cluster_9.pdb ( medoid)	3.49371	20.036	47.3786	70
cluster_10.pdb ( medoid)	1.42043	17.6003	35.5888	25