Project name: 17024af8840cfeb

Status: done

submitted: 2026-06-23 18:02:43, status changed: 2026-06-23 20:00:55

Project settings
Protein sequence(s) QGIGRKSAYGPVVVAQNAKEAEQKMTDGAVLVTKSTDRDMIASLEKASALITEEGGLTSHAAVVGLSLGIPVIVGLENATSILTDGQDITVDASRGAVYQGRASVL input pdb
Peptide sequence EETQQKQ
Simulation mc cycles50
Peptide secondary structure psipred CHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.5285 4.91618 25.3364 155
cluster_2.pdb ( medoid) 26.8882 7.66137 29.6681 206
cluster_3.pdb ( medoid) 15.0408 7.5794 19.0658 114
cluster_4.pdb ( medoid) 14.5537 8.86375 21.1415 129
cluster_5.pdb ( medoid) 10.9259 8.05422 21.3566 88
cluster_6.pdb ( medoid) 9.11577 7.0208 28.2315 64
cluster_7.pdb ( medoid) 8.48951 8.71664 21.5011 74
cluster_8.pdb ( medoid) 7.25779 11.5738 25.1369 84
cluster_9.pdb ( medoid) 5.69518 9.4817 21.3279 54
cluster_10.pdb ( medoid) 3.12519 10.2394 22.2049 32