CABS-dock: 17024af8840cfeb

Project name: 17024af8840cfeb

Status: done

submitted: 2026-06-23 18:02:43, status changed: 2026-06-23 20:00:55

Project settings

Protein sequence(s)	QGIGRKSAYGPVVVAQNAKEAEQKMTDGAVLVTKSTDRDMIASLEKASALITEEGGLTSHAAVVGLSLGIPVIVGLENATSILTDGQDITVDASRGAVYQGRASVL input pdb
Peptide sequence	EETQQKQ
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	31.5285	4.91618	25.3364	155
cluster_2.pdb ( medoid)	26.8882	7.66137	29.6681	206
cluster_3.pdb ( medoid)	15.0408	7.5794	19.0658	114
cluster_4.pdb ( medoid)	14.5537	8.86375	21.1415	129
cluster_5.pdb ( medoid)	10.9259	8.05422	21.3566	88
cluster_6.pdb ( medoid)	9.11577	7.0208	28.2315	64
cluster_7.pdb ( medoid)	8.48951	8.71664	21.5011	74
cluster_8.pdb ( medoid)	7.25779	11.5738	25.1369	84
cluster_9.pdb ( medoid)	5.69518	9.4817	21.3279	54
cluster_10.pdb ( medoid)	3.12519	10.2394	22.2049	32