CABS-dock: 172491ef8a1b534

Project name: 172491ef8a1b534

Status: done

submitted: 2025-04-14 15:53:19, status changed: 2025-04-14 19:34:30

Project settings

Protein sequence(s)	MTRLWASLLTVIIYILSQFLPLLIVKKLPFVQYSGIELTKAVIYIQLVLFLIAATTIILINLKIKNPTKLELEVKEPKKYIIPWALLGFALVMIYQMVVSIVLTQIYGGQQVSPNTEKLIIIARKIPIFIFFVSIIGPLLEEYVFRKVIFGELFNAIKGNRIVAFIIATTVSSLIFALAHNDFKFIPVYFGMGVIFSLAYVWTKRLAVPIIIHMLQNGFVVIFQLLNPEALKKATEQANFIYHIFIP input pdb
Peptide sequence	NIAAYSTCDFIM
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	72.0127	2.88838	20.5928	208
cluster_2.pdb ( medoid)	30.168	4.93901	14.2755	149
cluster_3.pdb ( medoid)	24.1448	3.35476	7.71205	81
cluster_4.pdb ( medoid)	19.6182	6.62649	21.1692	130
cluster_5.pdb ( medoid)	15.8504	8.95876	27.6536	142
cluster_6.pdb ( medoid)	14.994	6.00239	24.2742	90
cluster_7.pdb ( medoid)	13.6975	6.13249	18.5114	84
cluster_8.pdb ( medoid)	7.41711	6.06706	18.3881	45
cluster_9.pdb ( medoid)	5.89066	6.11137	11.4999	36
cluster_10.pdb ( medoid)	3.59777	9.72826	26.0798	35