Project name: 7NUI_THYEND_E2

Status: done

submitted: 2026-05-30 15:58:14, status changed: 2026-05-31 15:36:30

Project settings
Protein sequence(s) GSHSMRYFDTAMSRPGRGEPRFISSVGYVDDTQFVRFDSDAASPRMEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence THYENDSTDLRDHIDYWKHMRL
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCHHHHHHHHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 105.726 0.945842 4.93975 100
cluster_2.pdb ( medoid) 34.0476 2.99581 26.7952 102
cluster_3.pdb ( medoid) 22.8687 4.41653 31.1644 101
cluster_4.pdb ( medoid) 12.2611 9.46082 41.0921 116
cluster_5.pdb ( medoid) 11.0107 11.7158 31.5112 129
cluster_6.pdb ( medoid) 11.0062 11.8115 44.2211 130
cluster_7.pdb ( medoid) 9.28841 13.027 63.561 121
cluster_8.pdb ( medoid) 9.08301 9.90861 22.7387 90
cluster_9.pdb ( medoid) 4.30197 13.7147 36.1155 59
cluster_10.pdb ( medoid) 2.17543 23.9033 47.9411 52