CABS-dock: 17d629cd1c86659

Project name: 17d629cd1c86659

Status: done

submitted: 2026-04-10 04:21:15, status changed: 2026-04-10 15:13:11

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRVQLYPGSNDARRRH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	13.9156	11.4979	40.0016	160
cluster_2.pdb ( medoid)	13.8601	10.8225	41.0766	150
cluster_3.pdb ( medoid)	13.5528	10.1824	37.273	138
cluster_4.pdb ( medoid)	8.79556	15.8034	56.4993	139
cluster_5.pdb ( medoid)	7.92788	9.33414	28.8217	74
cluster_6.pdb ( medoid)	6.98922	15.5954	36.379	109
cluster_7.pdb ( medoid)	5.45725	15.3924	40.4708	84
cluster_8.pdb ( medoid)	4.29645	11.8703	33.4599	51
cluster_9.pdb ( medoid)	3.12935	14.38	26.6962	45
cluster_10.pdb ( medoid)	3.08379	16.2138	32.5834	50