CABS-dock: 1806eb04a391a32

Project name: 1806eb04a391a32

Status: done

submitted: 2026-03-19 09:40:20, status changed: 2026-03-19 12:57:25

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	KRLVQVFGSNTYRLK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.796	5.4631	23.2913	130
cluster_2.pdb ( medoid)	20.4075	6.71321	32.7735	137
cluster_3.pdb ( medoid)	19.6249	7.89814	46.8081	155
cluster_4.pdb ( medoid)	16.5216	9.44217	37.6854	156
cluster_5.pdb ( medoid)	7.05523	10.6304	21.4486	75
cluster_6.pdb ( medoid)	6.79552	10.4481	30.5383	71
cluster_7.pdb ( medoid)	5.76611	14.5679	40.2642	84
cluster_8.pdb ( medoid)	5.71785	14.5159	34.2147	83
cluster_9.pdb ( medoid)	3.7308	15.2782	40.0328	57
cluster_10.pdb ( medoid)	3.33667	15.5844	35.0358	52