Project name: 1806eb04a391a32

Status: done

submitted: 2026-03-19 09:40:20, status changed: 2026-03-19 12:57:25

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence KRLVQVFGSNTYRLK
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECCCCCEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.796 5.4631 23.2913 130
cluster_2.pdb ( medoid) 20.4075 6.71321 32.7735 137
cluster_3.pdb ( medoid) 19.6249 7.89814 46.8081 155
cluster_4.pdb ( medoid) 16.5216 9.44217 37.6854 156
cluster_5.pdb ( medoid) 7.05523 10.6304 21.4486 75
cluster_6.pdb ( medoid) 6.79552 10.4481 30.5383 71
cluster_7.pdb ( medoid) 5.76611 14.5679 40.2642 84
cluster_8.pdb ( medoid) 5.71785 14.5159 34.2147 83
cluster_9.pdb ( medoid) 3.7308 15.2782 40.0328 57
cluster_10.pdb ( medoid) 3.33667 15.5844 35.0358 52