CABS-dock: 1899f8fdc5515ae

Project name: 1899f8fdc5515ae

Status: done

submitted: 2026-01-20 05:17:41, status changed: 2026-01-20 17:25:56

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RVIFVQVGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.0541	7.31137	35.5813	132
cluster_2.pdb ( medoid)	16.9392	6.61188	47.6865	112
cluster_3.pdb ( medoid)	12.8758	11.2614	37.1687	145
cluster_4.pdb ( medoid)	12.7307	9.74022	54.0337	124
cluster_5.pdb ( medoid)	10.797	12.5034	43.6404	135
cluster_6.pdb ( medoid)	7.65684	13.0602	35.8334	100
cluster_7.pdb ( medoid)	6.34527	13.0806	36.0921	83
cluster_8.pdb ( medoid)	6.27113	14.3515	40.4323	90
cluster_9.pdb ( medoid)	1.97202	18.2554	36.7472	36
cluster_10.pdb ( medoid)	1.7251	24.9261	62.7121	43