Project name: V8-Pteroicidin-alpha-again-redock

Status: done

submitted: 2025-06-22 19:06:24, status changed: 2025-06-22 22:40:21

Project settings
Protein sequence(s) VILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQTNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA input pdb
Peptide sequence FIHHIIGGLFHVGKSIHDLIR
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 52.2422 1.99073 15.7497 104
cluster_2.pdb ( medoid) 29.3949 5.13695 30.8694 151
cluster_3.pdb ( medoid) 16.2054 12.7736 33.1522 207
cluster_4.pdb ( medoid) 13.4675 4.2324 22.3367 57
cluster_5.pdb ( medoid) 11.0904 12.4432 35.8256 138
cluster_6.pdb ( medoid) 10.8929 6.33438 21.9927 69
cluster_7.pdb ( medoid) 10.4354 10.0619 37.0815 105
cluster_8.pdb ( medoid) 9.6381 5.2915 19.4854 51
cluster_9.pdb ( medoid) 8.18856 10.2582 26.3905 84
cluster_10.pdb ( medoid) 3.60261 9.43761 24.49 34