CABS-dock: 195191acda72e0c

Project name: 195191acda72e0c

Status: done

submitted: 2026-02-27 07:42:08, status changed: 2026-02-27 14:09:27

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	VQVFGDNNW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.8127	3.93344	19.526	133
cluster_2.pdb ( medoid)	20.9916	7.241	42.742	152
cluster_3.pdb ( medoid)	17.4355	6.30898	35.1134	110
cluster_4.pdb ( medoid)	11.3749	14.4177	49.7217	164
cluster_5.pdb ( medoid)	7.44899	11.2767	30.5969	84
cluster_6.pdb ( medoid)	6.51335	14.8925	44.3711	97
cluster_7.pdb ( medoid)	5.29414	14.3555	37.7544	76
cluster_8.pdb ( medoid)	5.15337	10.8667	28.1858	56
cluster_9.pdb ( medoid)	4.10096	16.8253	55.1978	69
cluster_10.pdb ( medoid)	3.68264	16.0211	42.9932	59