CABS-dock: SPNTSDQSLMCT

Project name: SPNTSDQSLMCT

Status: done

submitted: 2026-04-02 08:14:31, status changed: 2026-04-02 08:48:24

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	SPNTSDQSLMCT
Simulation mc cycles	5
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	44.975	2.26793	19.8098	102
cluster_2.pdb ( medoid)	25.5677	4.2632	36.3405	109
cluster_3.pdb ( medoid)	20.4107	6.71217	22.3135	137
cluster_4.pdb ( medoid)	16.1822	10.011	23.4729	162
cluster_5.pdb ( medoid)	11.3428	10.5794	26.0235	120
cluster_6.pdb ( medoid)	10.5824	8.12671	23.7781	86
cluster_7.pdb ( medoid)	10.2946	9.51959	22.6446	98
cluster_8.pdb ( medoid)	7.22037	7.75583	30.2765	56
cluster_9.pdb ( medoid)	5.08081	8.85686	17.7028	45
cluster_10.pdb ( medoid)	3.33797	11.6837	29.9386	39