CABS-dock: A5HTU8-PEP4

Project name: A5HTU8-PEP4

Status: done

submitted: 2026-06-12 16:25:47, status changed: 2026-06-12 21:36:33

Project settings

Protein sequence(s)	GSHSMRYFSTAVSRPGLGEPRYLEVGYVDDTQFVRFDSDAPDPKMEQRAPWMEQVGPEYWDQETRRAKGNAQTFRVSLNNLRGYYNQSEAGSHTLQWMYGCDVGTDGRLLRGFMQYGYDGRDYIALNEDLRSWTAAETEAQITKRKWEKEGAAEARRNYLEGRCVEWLHRYLEIGKDTLQRSDPPKAHVTHHPISDREVTLRCWALGFYPEEISLTWQRSGEDQTQDMELVETRPSGDGTFQKWVALVVPSGEEQRYTCHVQHEGLQEPLTLRWEP input pdb
Peptide sequence	RRGIR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	50.172	2.49143	19.7063	125
cluster_2.pdb ( medoid)	43.1031	2.85362	15.8334	123
cluster_3.pdb ( medoid)	29.441	4.10991	35.668	121
cluster_4.pdb ( medoid)	28.6186	3.91354	32.1496	112
cluster_5.pdb ( medoid)	24.4617	4.53771	18.4072	111
cluster_6.pdb ( medoid)	20.8053	4.99873	12.9762	104
cluster_7.pdb ( medoid)	18.4398	5.47729	17.1546	101
cluster_8.pdb ( medoid)	17.6161	4.93867	10.7015	87
cluster_9.pdb ( medoid)	8.45514	7.8059	26.8839	66
cluster_10.pdb ( medoid)	4.40595	11.3483	39.9127	50