CABS-dock: LHO_Neg_EB

Project name: LHO_Neg_EB_M1R

Status: running

submitted: 2025-11-26 05:44:31, status changed: 2025-11-26 05:52:30

Project settings

Protein sequence(s)

MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPMIIATTDMQN input pdb

Peptide sequence

LAAAVAPLLRPLKKRALLAV

Simulation mc cycles

Peptide secondary structure psipred

CHHHHHHHHHHHHHHHHHCC

Unlikely to bind regions

186:A - 250:A

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue