CABS-dock: 1b5df0ebd5f29df

Project name: 1b5df0ebd5f29df

Status: done

submitted: 2026-07-08 09:36:56, status changed: 2026-07-08 13:22:11

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	ERPNAGFGPRLSGK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	16.9777	7.77489	29.5266	132
cluster_2.pdb ( medoid)	16.6359	10.6997	42.3433	178
cluster_3.pdb ( medoid)	16.0998	10.8697	28.8423	175
cluster_4.pdb ( medoid)	13.9588	5.15805	17.5912	72
cluster_5.pdb ( medoid)	11.4917	8.87599	26.6882	102
cluster_6.pdb ( medoid)	5.70201	18.7653	44.8145	107
cluster_7.pdb ( medoid)	4.61293	12.3566	25.501	57
cluster_8.pdb ( medoid)	4.40504	15.2098	34.5759	67
cluster_9.pdb ( medoid)	4.27559	17.5414	41.1911	75
cluster_10.pdb ( medoid)	2.20597	15.8661	31.2014	35