CABS-dock: 1bb668bf2b21e

Project name: 1bb668bf2b21e

Status: done

submitted: 2025-04-22 12:15:01, status changed: 2025-04-22 18:23:05

Project settings

Protein sequence(s)	AESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG input pdb
Peptide sequence	MSYVSLSGLSAAQLD
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEECCCCCHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.5116	5.79318	28.3405	142
cluster_2.pdb ( medoid)	19.0296	6.51618	19.4734	124
cluster_3.pdb ( medoid)	17.2046	6.50988	27.5342	112
cluster_4.pdb ( medoid)	17.0335	7.63204	28.4228	130
cluster_5.pdb ( medoid)	15.7187	9.09746	27.1646	143
cluster_6.pdb ( medoid)	14.7401	7.66616	30.723	113
cluster_7.pdb ( medoid)	10.2403	5.76155	13.6172	59
cluster_8.pdb ( medoid)	4.9093	12.6291	29.0253	62
cluster_9.pdb ( medoid)	4.40199	14.9932	32.2981	66
cluster_10.pdb ( medoid)	3.4421	14.2355	26.1818	49