Project name: 1bc7ea5343745dc

Status: done

submitted: 2026-04-12 11:20:07, status changed: 2026-04-12 15:44:24

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RRRVQLFGSNDARRY
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.4308 3.60167 26.3728 106
cluster_2.pdb ( medoid) 21.9141 5.5672 35.8233 122
cluster_3.pdb ( medoid) 17.2016 8.08063 27.9674 139
cluster_4.pdb ( medoid) 12.9107 13.3223 36.9888 172
cluster_5.pdb ( medoid) 11.472 10.7218 39.0988 123
cluster_6.pdb ( medoid) 8.27499 6.64653 27.187 55
cluster_7.pdb ( medoid) 7.91185 8.46831 32.862 67
cluster_8.pdb ( medoid) 6.65064 12.3296 26.3335 82
cluster_9.pdb ( medoid) 5.5028 14.9015 41.0026 82
cluster_10.pdb ( medoid) 3.59147 14.4788 29.9515 52