CABS-dock: 1c532601288c8ed

Project name: 1c532601288c8ed

Status: done

submitted: 2026-02-17 05:27:06, status changed: 2026-02-17 06:07:58

Project settings

Protein sequence(s)	FSDLWKLLPSPLPSQAMDDLMLSPDDIEQWFT input pdb
Peptide sequence	FDKLPGF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.7991	4.60446	18.5943	128
cluster_2.pdb ( medoid)	24.2366	6.51906	29.1326	158
cluster_3.pdb ( medoid)	19.761	5.11107	31.3721	101
cluster_4.pdb ( medoid)	19.3576	7.18065	32.6212	139
cluster_5.pdb ( medoid)	18.7581	6.82373	24.3533	128
cluster_6.pdb ( medoid)	12.3786	8.15927	22.6999	101
cluster_7.pdb ( medoid)	7.0898	9.73229	28.022	69
cluster_8.pdb ( medoid)	6.80806	11.6039	30.2891	79
cluster_9.pdb ( medoid)	3.16817	15.1507	42.2348	48
cluster_10.pdb ( medoid)	2.98516	16.4145	43.9496	49