Project name: 1c74239e980cecf

Status: done

submitted: 2026-03-15 13:53:34, status changed: 2026-03-15 16:59:42

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence IKIWFQNRRMKWGGVQVFGSNTY
Simulation mc cycles50
Peptide secondary structure psipred CCEEEECCCCCCCCEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.0504 4.51009 23.1905 122
cluster_2.pdb ( medoid) 16.6732 10.0161 26.6758 167
cluster_3.pdb ( medoid) 10.9634 7.0234 27.3994 77
cluster_4.pdb ( medoid) 10.1936 13.8322 28.3531 141
cluster_5.pdb ( medoid) 8.17852 8.06992 27.205 66
cluster_6.pdb ( medoid) 7.85103 14.393 26.094 113
cluster_7.pdb ( medoid) 7.14864 14.9679 26.6191 107
cluster_8.pdb ( medoid) 6.75711 12.1354 26.4739 82
cluster_9.pdb ( medoid) 5.68381 12.8435 27.985 73
cluster_10.pdb ( medoid) 3.79851 13.6896 26.3411 52